RecipeAI
DashboardDiscoverMeal PlanGroceriesCreateImportRecipe Box
BlogSign InGet Started
Dashboard
Plan
Nutrition
Create
Groceries
Saved
Profile
RecipeAI LogoRecipeAI

AI-powered recipes, meal plans, and nutrition tracking — personalized to your tastes and goals.

Explore

  • Discover Recipes
  • Categories
  • World Cuisines
  • Diets
  • Quick Meals
  • Meal Plans by Diet
  • Kitchen Conversions
  • Calories in Foods

Features

  • AI Recipe Generator
  • Meal Planning
  • Nutrition Tracker
  • Macro Calculator
  • Nutrition Guides
  • Food Diary
  • Recipe Import
  • Pricing

Resources

  • Blog
  • About Us
  • Feedback

© 2026 RecipeAI. All rights reserved.

Cook smarter, eat better.

More recipes like this

  • Creamy Overnight Gluten-Free Oats with Greek Yogurt, Maple, Citrus & Toasted Pistachios
  • Creamy Overnight Oats with Berries & Toasted Almonds
  • Silky Berry-Chia Overnight Oats with Toasted Walnuts
  • Overnight Oats with Roasted Pear, Walnuts & Orange Zest (Quick Prep)
  • Winter Kale & Pear Smoothie Bowl with Hemp, Ginger & Toasted Oats
  • Creamy Polenta Porridge with Roasted Pears & Toasted Hazelnuts (Dairy-Free)
  • Browse all recipes →
Pear‑Cinnamon Overnight Oats with Toasted Hazelnuts

Pear‑Cinnamon Overnight Oats with Toasted Hazelnuts

By j

Contemporary American/European breakfastBeginner

Creamy, subtly spiced overnight oats studded with sweet diced pear and finished with crunchy toasted hazelnuts. The oats soak overnight in milk and chia, creating a luscious, spoonable texture while cinnamon and maple syrup add warm sweetness; toasted hazelnuts deliver a smoky, buttery crunch that lifts every bite.

Prep: 10 minutes
Cook: 6–8 hours (overnight chilling)
Total: 6 hours 10 minutes (minimum)
1 servings
breakfastvegetarianmake-aheadhealthysnack

Ingredients

  • 1/2 cup (45 g) rolled oats
  • 3/4 cup (180 ml) milk (2% recommended) or plant milk (unsweetened almond, oat, etc.)
  • 1/2 pear (about 65 g) ripe pear, diced
  • 1 tbsp (about 12 g) chia seeds
  • 1/2 tsp ground cinnamon
  • 1 tbsp (about 8 g) toasted hazelnuts, chopped
  • 1 tsp (about 5 ml) maple syrup (optional)
  • a pinch fine sea salt
  • 1/4 tsp vanilla extract (optional)

Instructions

1

Toast the hazelnuts (if not pre-toasted): Place the 1 tbsp chopped hazelnuts in a dry skillet over medium heat. Shake the pan or stir frequently for 3–4 minutes until they smell nutty and the skins show light browning. Toasting releases the oils and deepens flavor; it also creates a more satisfying crunch against the creamy oats. Transfer to a plate to cool so they stop cooking.

2

Dice the pear: Trim any stem, then halve the pear and dice half (about 65 g) into 1/4-inch (6 mm) pieces. Keep the skin on for texture and color unless you prefer peeled fruit. Small, even dice ensures pear pieces stay tender and disperse flavor evenly through the oats.

3

Combine the base: In a 12–16 ounce jar or airtight container, add 1/2 cup (45 g) rolled oats, 1 tbsp chia seeds, and 1/2 tsp ground cinnamon. Add a small pinch of fine sea salt to heighten sweetness and balance the flavors. Salt is a flavor amplifier—it makes the pears and cinnamon taste brighter.

4

Add liquids and mix: Pour in 3/4 cup (180 ml) milk (or plant milk) and 1/4 tsp vanilla extract if using. Stir vigorously for 20–30 seconds to ensure the chia seeds are evenly distributed and start absorbing liquid; this prevents clumping. Mixing also hydrates the oats' surface so they soften uniformly overnight.

5

Fold in fruit and sweetener: Gently fold the diced pear into the oat mixture, reserving a few pieces for the top if you like. If you want a touch of extra sweetness, stir in 1 tsp maple syrup now—this balances the natural pear tartness and complements cinnamon. Because maple is optional, taste in the morning and add more if needed.

6

Seal and chill: Press a piece of plastic wrap directly on the surface (optional) and screw on the lid. Refrigerate at least 6 hours or overnight (6–8 hours). The resting time allows oats and chia to absorb the milk, creating a creamy, pudding-like texture without cooking. Chilling also allows the flavors to meld.

7

Check and adjust in the morning: Give the oats a stir. If the mixture is thicker than you prefer, stir in 1–2 tbsp additional milk to loosen (liquid is absorbed over time). Taste and adjust sweetness with a little more maple if desired. Textural adjustment here is important—overnight soaking yields a range from spoonable to porridge-thick, so personalize.

8

Finish and serve: Top with the toasted chopped hazelnuts and the reserved pear dice. If you like a contrast in texture and temperature, warm the hazelnuts for 10 seconds in a skillet or microwave before topping to revive aroma. Serve chilled or at room temperature.

9

Make-ahead and storage notes: Keep refrigerated up to 3 days in a sealed container. If storing longer, add nuts and fresh fruit only when serving to preserve crunch and color. For travel, use a jar with a tight-fitting lid and include the nuts separately to prevent softening.

Chef's Tips

  • 1Use a jar with straight sides for even layering and easier stirring. Wide-mouth Mason jars are ideal for overnight oats.
  • 2To avoid a gummy chia texture, stir thoroughly after adding milk and again once after 10–15 minutes; this helps chia seeds separate and hydrate evenly.
  • 3If using a sweeter plant milk (like sweetened almond or oat milk), reduce or omit the maple syrup to avoid an overly sweet bowl.
  • 4Common mistake: adding the nuts too early makes them lose crunch. Always toast and add them at the end.
  • 5Flavor booster: a tiny grating of fresh lemon zest (1/4 tsp) over the pears before chilling brightens the fruit’s flavor without making it tart.

Variations

  • Spiced Walnut Swap: Replace hazelnuts with toasted walnuts or pecans and add a pinch of ground cardamom for a warm, autumnal profile.
  • Vegan / Lower‑calorie option: Use unsweetened almond or cashew milk instead of dairy milk and omit the maple syrup or replace it with a few drops of liquid stevia.
  • Make it bake‑style: For a warm-textured breakfast, transfer the soaked mixture to a small ovenproof dish, top with sliced pears and chopped hazelnuts, and bake at 350°F (175°C) for 12–15 minutes just until warm and slightly set.

Nutrition per Serving

432

Calories

17g

Protein

60g

Carbs

16g

Fat

12g

Fiber

Rate this Recipe

How did this recipe turn out? Let others know!

to rate this recipe

Pear‑Cinnamon Overnight Oats with Toasted Hazelnuts

By j

breakfastvegetarianmake-aheadhealthysnack
Pear‑Cinnamon Overnight Oats with Toasted Hazelnuts - rolled oats, milk (2% recommended) or plant milk (unsweetened almond, oat, etc.) recipe

Creamy, subtly spiced overnight oats studded with sweet diced pear and finished with crunchy toasted hazelnuts. The oats soak overnight in milk and chia, creating a luscious, spoonable texture while cinnamon and maple syrup add warm sweetness; toasted hazelnuts deliver a smoky, buttery crunch that lifts every bite.

Contemporary American/European breakfastBeginner1 servings
Prep: 10 minutes
Cook: 6–8 hours (overnight chilling)
6 hours 10 minutes (minimum)

Ingredients

  • 1/2 cup (45 g) rolled oats
  • 3/4 cup (180 ml) milk (2% recommended) or plant milk (unsweetened almond, oat, etc.)
  • 1/2 pear (about 65 g) ripe pear, diced
  • 1 tbsp (about 12 g) chia seeds
  • 1/2 tsp ground cinnamon
  • 1 tbsp (about 8 g) toasted hazelnuts, chopped
  • 1 tsp (about 5 ml) maple syrup (optional)
  • a pinch fine sea salt
  • 1/4 tsp vanilla extract (optional)

Instructions

1

Toast the hazelnuts (if not pre-toasted): Place the 1 tbsp chopped hazelnuts in a dry skillet over medium heat. Shake the pan or stir frequently for 3–4 minutes until they smell nutty and the skins show light browning. Toasting releases the oils and deepens flavor; it also creates a more satisfying crunch against the creamy oats. Transfer to a plate to cool so they stop cooking.

2

Dice the pear: Trim any stem, then halve the pear and dice half (about 65 g) into 1/4-inch (6 mm) pieces. Keep the skin on for texture and color unless you prefer peeled fruit. Small, even dice ensures pear pieces stay tender and disperse flavor evenly through the oats.

3

Combine the base: In a 12–16 ounce jar or airtight container, add 1/2 cup (45 g) rolled oats, 1 tbsp chia seeds, and 1/2 tsp ground cinnamon. Add a small pinch of fine sea salt to heighten sweetness and balance the flavors. Salt is a flavor amplifier—it makes the pears and cinnamon taste brighter.

4

Add liquids and mix: Pour in 3/4 cup (180 ml) milk (or plant milk) and 1/4 tsp vanilla extract if using. Stir vigorously for 20–30 seconds to ensure the chia seeds are evenly distributed and start absorbing liquid; this prevents clumping. Mixing also hydrates the oats' surface so they soften uniformly overnight.

5

Fold in fruit and sweetener: Gently fold the diced pear into the oat mixture, reserving a few pieces for the top if you like. If you want a touch of extra sweetness, stir in 1 tsp maple syrup now—this balances the natural pear tartness and complements cinnamon. Because maple is optional, taste in the morning and add more if needed.

6

Seal and chill: Press a piece of plastic wrap directly on the surface (optional) and screw on the lid. Refrigerate at least 6 hours or overnight (6–8 hours). The resting time allows oats and chia to absorb the milk, creating a creamy, pudding-like texture without cooking. Chilling also allows the flavors to meld.

7

Check and adjust in the morning: Give the oats a stir. If the mixture is thicker than you prefer, stir in 1–2 tbsp additional milk to loosen (liquid is absorbed over time). Taste and adjust sweetness with a little more maple if desired. Textural adjustment here is important—overnight soaking yields a range from spoonable to porridge-thick, so personalize.

8

Finish and serve: Top with the toasted chopped hazelnuts and the reserved pear dice. If you like a contrast in texture and temperature, warm the hazelnuts for 10 seconds in a skillet or microwave before topping to revive aroma. Serve chilled or at room temperature.

9

Make-ahead and storage notes: Keep refrigerated up to 3 days in a sealed container. If storing longer, add nuts and fresh fruit only when serving to preserve crunch and color. For travel, use a jar with a tight-fitting lid and include the nuts separately to prevent softening.

Chef's Tips

  • 1Use a jar with straight sides for even layering and easier stirring. Wide-mouth Mason jars are ideal for overnight oats.
  • 2To avoid a gummy chia texture, stir thoroughly after adding milk and again once after 10–15 minutes; this helps chia seeds separate and hydrate evenly.
  • 3If using a sweeter plant milk (like sweetened almond or oat milk), reduce or omit the maple syrup to avoid an overly sweet bowl.
  • 4Common mistake: adding the nuts too early makes them lose crunch. Always toast and add them at the end.
  • 5Flavor booster: a tiny grating of fresh lemon zest (1/4 tsp) over the pears before chilling brightens the fruit’s flavor without making it tart.

Variations

  • Spiced Walnut Swap: Replace hazelnuts with toasted walnuts or pecans and add a pinch of ground cardamom for a warm, autumnal profile.
  • Vegan / Lower‑calorie option: Use unsweetened almond or cashew milk instead of dairy milk and omit the maple syrup or replace it with a few drops of liquid stevia.
  • Make it bake‑style: For a warm-textured breakfast, transfer the soaked mixture to a small ovenproof dish, top with sliced pears and chopped hazelnuts, and bake at 350°F (175°C) for 12–15 minutes just until warm and slightly set.

Nutrition per Serving

432

Calories

17g

Protein

60g

Carbs

16g

Fat

12g

Fiber

Rate this Recipe

Your Rating:

Explore More

🥗 vegetarian Recipes🥘 More with rolled oats🥘 More with milk (2% recommended) or plant milk (unsweetened almond, oat, etc.)🥘 More with ripe pear, diced

Similar Recipes